Loading...
Statistics
Advertisement

GALAXY MACAU澳门银河国际
www.006md.com/
GALAXY MACAU澳门银河国际

006md.com

Advertisement
Conversion Technology Metas Server
006md.com is hosted in India . 006md.com uses HTTPS protocol. Number of used technologies: 4. First technologies: Html, Html5, Iframe, Number of used javascripts: 0. Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by 006md.com

Technology

Number of occurences: 4
  • Html
  • Html5
  • Iframe
  • Php

Advertisement

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Google Analytics ID

  • UA-59062215-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 006md.com

SSL certificate

    • name: /C=CA/CN=bb-in.com
    • subject:
      • C: CA
      • CN: bb-in.com
    • hash: c098a10a
    • issuer:
      • C: CA
      • CN: bb-in.com
    • version: 3
    • serialNumber: 13637505924934054631
    • validFrom: 110103175717Z
    • validTo: 201231175717Z
    • validFrom_time_t: 1294077437
    • validTo_time_t: 1609437437
    • extensions:

    Meta - 006md.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=UTF-8
    • Name: keywords
      Content: GALAXY MACAU澳门银河国际
    • Name: description
      Content: GALAXY MACAU澳门银河国际

    Server / Hosting

    • IP: 103.241.10.90
    • Latitude: 20.00
    • Longitude: 77.00
    • Country: India

    Rname

    • snt4buf.md568cne.com
    • snm1buf.md568cne.com
    • snn3buf.md568cne.com
    • snp2buf.md568cne.com

    Target

    • root.localhost

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 23 Aug 2016 22:02:28 GMT Expires: Mon,26 Jul 1997 08:00:00 GMT Last-Modified: Tue, 23 Aug 2016 22:02:28 GMT Cache-Control: no-cache Pragma: no-cache Set-Cookie: langx=gb; path=/ Set-Cookie: SESSION_ID=guest; path=/; domain=006md.com; httponly Set-Cookie: ISID=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; Max-Age=0; path=/; domain=006md.com; httponly Set-Cookie: LOGINCHK=N; path=/; domain=006md.com Vary: Accept-Encoding Content-Type: text/html Server: Apache Set-Cookie: T1-IplWeb-Statsbbbbbbbbbbbbbbbb=AEAPELDOAHLCCAAANLEFMODKPGECCHHBNENFNNNNJKADOEKKEGCIILJLIFIANICJJHOLNCAKFMCINLFOKMEPADMIFCFEMFHONGDKEAHBKAOJFIFELOHEKBAGGGBEOEHH; HttpOnly X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: A
    4. ip: 103.241.10.90
    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: NS
    4. target: snt4buf.md568cne.com
    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: NS
    4. target: snm1buf.md568cne.com
    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: NS
    4. target: snn3buf.md568cne.com
    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: NS
    4. target: snp2buf.md568cne.com
    host: 006md.com
    1. class: IN
    2. ttl: 1200
    3. type: SOA
    4. mname: ns54.006md.com
    5. rname: root.localhost
    6. serial: 1608170001
    7. refresh: 7200
    8. retry: 1800
    9. expire: 604800
    10. minimum-ttl: 30

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.06md.com, www.0i06md.com, www.i06md.com, www.0o06md.com, www.o06md.com, www.0p06md.com, www.p06md.com, www.0806md.com, www.806md.com, www.0i06md.com, www.i06md.com, www.0o06md.com, www.o06md.com, www.06md.com, www.00i6md.com, www.0i6md.com, www.00o6md.com, www.0o6md.com, www.00p6md.com, www.0p6md.com, www.0086md.com, www.086md.com, www.00i6md.com, www.0i6md.com, www.00o6md.com, www.0o6md.com, www.00md.com, www.006rmd.com, www.00rmd.com, www.006tmd.com, www.00tmd.com, www.006zmd.com, www.00zmd.com, www.006ymd.com, www.00ymd.com, www.0064md.com, www.004md.com, www.006d.com, www.006mpd.com, www.006pd.com, www.006mod.com, www.006od.com, www.006mid.com, www.006id.com, www.006mkd.com, www.006kd.com, www.006m.d.com, www.006.d.com, www.006mud.com, www.006ud.com, www.006mjd.com, www.006jd.com, www.006mnd.com, www.006nd.com, www.006m-d.com, www.006-d.com, www.006m.com, www.006mdt.com, www.006mt.com, www.006mdg.com, www.006mg.com, www.006mdb.com, www.006mb.com, www.006mdx.com, www.006mx.com, www.006mds.com, www.006ms.com, www.006mdf.com, www.006mf.com, www.006mdv.com, www.006mv.com, www.006mdy.com, www.006my.com, www.006mdz.com, www.006mz.com, www.006mda.com, www.006ma.com, www.006mde.com, www.006me.com, www.006mdr.com, www.006mr.com,

    Other websites we recently analyzed

    1. Müzik Prodüksiyonu için ihtiyaçınız olan her şey!
      Müzik ve ses prodüksiyonu ile görsel sanatlar alanında ihtiyaçınız olan her şeye çözümler sunuyoruz.
      Bursa (Turkey) - 37.247.110.3
      Server software: LiteSpeed
      Technology: Carousel, CSS, Datepicker, Fancybox, Html, Html5, Javascript, jQuery, jQuery Cookie, JW Player, Php, Pingback, SVG, Google Analytics, Wordpress
      Number of Javascript: 13
      Number of meta tags: 10
    2. Indbovurdering
      Denmark - 81.19.232.68
      Server software: Apache SSD/Vfast 2.29ea
      Technology: CSS, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
      Number of Javascript: 9
      Number of meta tags: 3
    3. Nelson Clean Care For a Cleaner, Healthier Home
      Integrity and honesty are our foundation. Our years of experience equip us to guide our customers through a potentially emotional and crisis driven experience.
      Brea (United States) - 208.113.220.78
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, jQuery, Php, SuperFish, Swf Object, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 4
    4. minipli.net
      Germany - 144.76.92.157
      Server software: Apache
      Technology: Html
    5. Yes You Can Recipes
      Recipes and tips for pre-diabetic and diabetic cookery
      Canada - 174.142.40.130
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 3
    6. nancykhawamfamilylawandmediation.org
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    7. Home - RSM Connect - Breitband für das Berchtesgadener Land und Landkreis Traunstein
      Germany - 80.255.15.136
      Server software: Apache/2.2.15 (Unix) DAV/2 mod_fcgid/2.3.6-dev SVN/1.6.11
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 4
      Number of meta tags: 3
    8. Immobilier Dompierrois
      France - 195.154.216.236
      Server software: Apache/2.4.9 (Win64) PHP/5.5.12
      Technology: CSS, Google Font API, Html, Iframe, Javascript, Php, Swf Object, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 1
    9. PSD to Responsive HTML5 & CSS - Slice PSD - Save 40% on every order
      Pixel perfect PSD to HTML5 and CSS converting services: PSD to Email, WordPress, Magento, global coding standards, world class quality at great prices. Full money back guarantee.
      Lansing (United States) - 50.28.14.165
      G Analytics ID: UA-55736473-1
      Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: CSS, Html, Html5, Javascript, SuperFish, Zopim Live Chat, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 4
    10. BM Scavi
      Arezzo (Italy) - 62.149.144.108
      G Analytics ID: UA-65976169-1
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SVG, Google Analytics, Wordpress
      Number of Javascript: 11
      Number of meta tags: 4

    Check Other Websites